EDIL3 Fragment MS Protein Standard

Product Information
Protein Name
EGF-like repeat and discoidin I-like domain-containing protein 3
Description
EDIL3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EDIL3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
EDIL3
Synonyms
Developmentally-regulated endothelial cell locus 1 protein, Integrin-binding protein DEL1
Uniprot ID
O43854
Product Sequence
NGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAE

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket