EID2 Fragment MS Protein Standard

EP300-interacting inhibitor of differentiation 2

EID2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EID2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

EID2

CREBBP/EP300 inhibitor 2, EID-1-like inhibitor of differentiation 2

Q8N6I1

AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE