ENC1 Fragment MS Protein Standard

Ectoderm-neural cortex protein 1

ENC1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ENC1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ENC1

Kelch-like protein 37, Nuclear matrix protein NRP/B, p53-induced gene 10 protein

O14682

ASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRT