ERV3-1 Fragment MS Protein Standard

Endogenous retrovirus group 3 member 1 Env polyprotein

ERV3-1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ERV3-1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ERV3-1

ERV-3 envelope protein, ERV3-1 envelope protein, Envelope polyprotein, HERV-R envelope protein, HERV-R_7q21.2 provirus ancestral Env polyprotein

Q14264

QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA