FAM162A Fragment MS Protein Standard

Protein FAM162A

FAM162A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FAM162A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FAM162A

E2-induced gene 5 protein, Growth and transformation-dependent protein

Q96A26

SSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRV