Description
FBXL21 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FBXL21 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Synonyms
F-box and leucine-rich repeat protein 21, F-box and leucine-rich repeat protein 3B, F-box/LRR-repeat protein 3B
Product Sequence
DALIKHSPRVNVVMHFFLYEEEFETFFKEETPVTHLYFGRSVSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERR
If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!
* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
