FBXL6 Fragment MS Protein Standard

F-box/LRR-repeat protein 6

FBXL6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FBXL6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FBXL6

F-box and leucine-rich repeat protein 6, F-box protein FBL6, FBL6A

Q8N531

INRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYG