FBXW8 Fragment MS Protein Standard

F-box/WD repeat-containing protein 8

FBXW8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FBXW8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FBXW8

F-box and WD-40 domain-containing protein 8, F-box only protein 29

Q8N3Y1

EDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKA