FEM1B Fragment MS Protein Standard

Protein fem-1 homolog B

FEM1B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FEM1B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FEM1B

FEM1-beta, Fem-1-like death receptor-binding protein alpha, Fem-1-like in apoptotic pathway protein alpha

Q9UK73

NSALHIIVQYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTL