FICD Fragment MS Protein Standard

Adenosine monophosphate-protein transferase FICD

FICD Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FICD protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FICD

AMPylator FICD, FIC domain-containing protein, Huntingtin yeast partner E, Huntingtin-interacting protein 13, Huntingtin-interacting protein E

Q9BVA6

CLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPD