FRK Fragment MS Protein Standard

Tyrosine-protein kinase FRK

FRK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FRK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FRK

FYN-related kinase, Nuclear tyrosine protein kinase RAK, Protein-tyrosine kinase 5

P42685

MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDK