FRYL Fragment MS Protein Standard

Protein furry homolog-like

FRYL Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FRYL protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FRYL

ALL1-fused gene from chromosome 4p12 protein

O94915

EEVLQIRDETPTLEASLDNANSRLPEDTTSVLKEEHVTTFEDEGSYIIQEQQESLVCQGILDLEETEMPEPLAPESYPESVC