FUT10 Fragment MS Protein Standard

Alpha-(1,3)-fucosyltransferase 10

FUT10 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FUT10 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FUT10

Fucosyltransferase X, Galactoside 3-L-fucosyltransferase 10

Q6P4F1

LGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHH