G0S2 Fragment MS Protein Standard

G0/G1 switch protein 2

G0S2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human G0S2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

G0S2

G0/G1 switch regulatory protein 2, Putative lymphocyte G0/G1 switch gene

P27469

PFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHA