GJC3 Fragment MS Protein Standard

Gap junction gamma-3 protein

GJC3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GJC3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GJC3

Connexin-30.2, Connexin-31.3, Gap junction epsilon-1 protein

Q8NFK1

RTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA