GLG1 Fragment MS Protein Standard

Golgi apparatus protein 1

GLG1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GLG1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GLG1

CFR-1, Cysteine-rich fibroblast growth factor receptor, E-selectin ligand 1, Golgi sialoglycoprotein MG-160

Q92896

ILSCLMEHLYTEKMVEDCEHRLLELQYFISRDWKLDPVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHAYRTEEQGRRLSRECRAEVQRILHQRAMDVK