GNLY Fragment MS Protein Standard

Granulysin

GNLY Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GNLY protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GNLY

Lymphokine LAG-2, Protein NKG5, T-cell activation protein 519

P22749

RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKP