GSTK1 Fragment MS Protein Standard

Glutathione S-transferase kappa 1

GSTK1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GSTK1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GSTK1

GST 13-13, GST class-kappa, GSTK1-1, Glutathione S-transferase subunit 13

Q9Y2Q3

QAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVN