GTF2E1 Fragment MS Protein Standard

Product Information
Protein Name
General transcription factor IIE subunit 1
Description
GTF2E1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GTF2E1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
GTF2E1
Synonyms
General transcription factor IIE 56 kDa subunit, Transcription initiation factor IIE subunit alpha
Uniprot ID
P29083
Product Sequence
RNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket