HBZ Fragment MS Protein Standard

Product Information
Protein Name
Hemoglobin subunit zeta
Description
HBZ Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HBZ protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
HBZ
Synonyms
HBAZ, Hemoglobin zeta chain, Zeta-globin
Uniprot ID
P02008
Product Sequence
TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket