HIF3A Fragment MS Protein Standard

Hypoxia-inducible factor 3-alpha

HIF3A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HIF3A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HIF3A

Basic-helix-loop-helix-PAS protein MOP7, Class E basic helix-loop-helix protein 17, HIF3-alpha-1, Inhibitory PAS domain protein, Member of PAS protein 7, PAS domain-containing protein 7

Q9Y2N7

SPPALEPSLLPRWGSDPRLSCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLL