HIVEP3 Fragment MS Protein Standard

Product Information
Protein Name
Transcription factor HIVEP3
Description
HIVEP3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HIVEP3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
HIVEP3
Synonyms
Human immunodeficiency virus type I enhancer-binding protein 3, Kappa-B and V(D)J recombination signal sequences-binding protein, Kappa-binding protein 1, Zinc finger protein ZAS3
Uniprot ID
Q5T1R4
Product Sequence
TEDGKRPEKSHLGNQGQGRRELEMLSSLSSDPSDTKEIPPLPHPALSHGTAPGSEALKEYPQPSGKPHRRGLTPLSVKKEDSKEQPDLP

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket