HMG20B Fragment MS Protein Standard

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related

HMG20B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HMG20B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HMG20B

BRCA2-associated factor 35, HMG box-containing protein 20B, HMG domain-containing protein 2, HMG domain-containing protein HMGX2, Sox-like transcriptional factor, Structural DNA-binding protein BRAF35

Q9P0W2

GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV