HMGA1 Full-Length MS Protein Standard

Product Information
Protein Name
high mobility group AT-hook 1
Description
HMGA1 Full-Length MS Protein Standard (NP_665911), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293 cells (HEK293) with fully chemically defined cell culture medium to obtain incorporation efficiency at Creative-Proteomics. This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene.
Symbol
HMGA1
Synonyms
HMG-R, HMGIY, HMGA1A, MGC4242, MGC4854, MGC12816;AL023995; HMG-I(Y); HMGI(Y); HMGY; Hmga1a; Hmga1b; Hmgi; Hmgiy; MGC102580; high mobility group protein I; high mobility group AT-hook 1
Accession
NM_145904
Cytogenetic
6p21
Amino Acid Labeled
[U- 13C6, 15N4]-L-Arg and [U- 13C6, 15N2]-L-Lys
Chemical Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Expression Host
Human HEK293 cells
Predicted MW
11.5 kDa
Expression True or False Clone
RC217302
Protein Sequence
>RC217302 representing NM_145904
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA
KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket