HPS5 Fragment MS Protein Standard

Hermansky-Pudlak syndrome 5 protein

HPS5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HPS5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HPS5

Alpha-integrin-binding protein 63, Ruby-eye protein 2 homolog

Q9UPZ3

STSTMDDEGYPRPHSHLLSWGYSQLILHLIKLPADFITKEKMTDICRSCGFWPGYLILCLELERRREAFTNIVYLND