HSD17B2 Fragment MS Protein Standard

Estradiol 17-beta-dehydrogenase 2

HSD17B2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HSD17B2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HSD17B2

17-beta-hydroxysteroid dehydrogenase type 2, 20 alpha-hydroxysteroid dehydrogenase, E2DH, Microsomal 17-beta-hydroxysteroid dehydrogenase, Testosterone 17-beta-dehydrogenase

P37059

LVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTV