HTR3A Fragment MS Protein Standard

5-hydroxytryptamine receptor 3A

HTR3A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HTR3A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HTR3A

5-hydroxytryptamine receptor 3, Serotonin receptor 3A, Serotonin-gated ion channel receptor

P46098

LRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEI