HUS1B Fragment MS Protein Standard

Checkpoint protein HUS1B

HUS1B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human HUS1B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

HUS1B

AP1 subunit gamma-binding protein 1, Gamma-synergin

Q8NHY5

MKFRAKITGKGCLELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAFQQFRMEGVSEDLDEIHLELTAEHL