IGFBPL1 Fragment MS Protein Standard

Insulin-like growth factor-binding protein-like 1

IGFBPL1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IGFBPL1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IGFBPL1

IGFBP-related protein 10, Insulin-like growth factor-binding-related protein 4

Q8WX77

WRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGV