IL36B Fragment MS Protein Standard

Interleukin-36 beta

IL36B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IL36B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IL36B

FIL1 eta, Interleukin-1 eta, Interleukin-1 family member 8, Interleukin-1 homolog 2

Q9NZH7

PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP