IL36G Fragment MS Protein Standard

Interleukin-36 gamma

IL36G Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IL36G protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IL36G

IL-1-related protein 2, Interleukin-1 epsilon, Interleukin-1 family member 9, Interleukin-1 homolog 1

Q9NZH8

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQP