INO80B Fragment MS Protein Standard

INO80 complex subunit B

INO80B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human INO80B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

INO80B

High mobility group AT-hook 1-like 4, IES2 homolog, PAP-1-associated protein 1, Zinc finger HIT domain-containing protein 4

Q9C086

PMVRYCSGAQGSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPGS