IRF2BPL Fragment MS Protein Standard

Interferon regulatory factor 2-binding protein-like

IRF2BPL Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IRF2BPL protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IRF2BPL

Enhanced at puberty protein 1

Q9H1B7

SLRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAG