IRX5 Fragment MS Protein Standard

Iroquois-class homeodomain protein IRX-5

IRX5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IRX5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IRX5

Homeodomain protein IRX-2A, Homeodomain protein IRXB2, Iroquois homeobox protein 5

P78411

MTWTPRNRSEDEEEEENIDLEKNDEDEPQKPEDKGDPEGPEAGGAEQKAASGCERLQGPPTPAGKETEG