ISX Fragment MS Protein Standard

Intestine-specific homeobox

ISX Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ISX protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ISX

RAX-like homeobox

Q2M1V0

RGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEAAASGSGLEKPPKDQPQEGRK