KCNIP3 Fragment MS Protein Standard

Calsenilin

KCNIP3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KCNIP3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KCNIP3

A-type potassium channel modulatory protein 3, DRE-antagonist modulator, Kv channel-interacting protein 3

Q9Y2W7

SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF