KCNJ14 Fragment MS Protein Standard

ATP-sensitive inward rectifier potassium channel 14

KCNJ14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KCNJ14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KCNJ14

Inward rectifier K(+) channel Kir2.4, Potassium channel, inwardly rectifying subfamily J member 14

Q9UNX9

SGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKD