KCNJ8 Fragment MS Protein Standard

ATP-sensitive inward rectifier potassium channel 8

KCNJ8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KCNJ8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KCNJ8

Inward rectifier K(+) channel Kir6.1, Potassium channel, inwardly rectifying subfamily J member 8, uKATP-1

Q15842

KRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNT