KCNK17 Fragment MS Protein Standard

Potassium channel subfamily K member 17

KCNK17 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KCNK17 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KCNK17

2P domain potassium channel Talk-2, Acid-sensitive potassium channel protein TASK-4, TWIK-related acid-sensitive K(+) channel 4, TWIK-related alkaline pH-activated K(+) channel 2

Q96T54

RLGHLMQQGVNHWASRLGGTWQDPDKARWL