KDM2A Fragment MS Protein Standard

Lysine-specific demethylase 2A

KDM2A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KDM2A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KDM2A

CXXC-type zinc finger protein 8, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, JmjC domain-containing histone demethylation protein 1A, [Histone-H3]-lysine-36 demethylase 1A

Q9Y2K7

EPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHK