KDM4D Fragment MS Protein Standard

Lysine-specific demethylase 4D

KDM4D Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KDM4D protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KDM4D

JmjC domain-containing histone demethylation protein 3D, Jumonji domain-containing protein 2D

Q6B0I6

EAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKMASQCSCGEARVTFSMDAFVRILQPERYDLWKRGQDRAVVDHMEPRVPASQELSTQKEVQLP