KDM4D Fragment MS Protein Standard

Product Information
Protein Name
Lysine-specific demethylase 4D
Description
KDM4D Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KDM4D protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
KDM4D
Synonyms
JmjC domain-containing histone demethylation protein 3D, Jumonji domain-containing protein 2D
Uniprot ID
Q6B0I6
Product Sequence
LRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRRSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSN

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket