KLF15 Fragment MS Protein Standard

Krueppel-like factor 15

KLF15 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KLF15 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KLF15

Kidney-enriched krueppel-like factor

Q9UIH9

PVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPG