KLHL41 Fragment MS Protein Standard

Kelch-like protein 41

KLHL41 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KLHL41 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KLHL41

Kel-like protein 23, Kelch repeat and BTB domain-containing protein 10, Kelch-related protein 1, Sarcosin

O60662

GDKSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQD