KNDC1 Fragment MS Protein Standard

Protein very KIND

KNDC1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KNDC1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KNDC1

Cerebral protein 9, KIND domain-containing protein 1, Kinase non-catalytic C-lobe domain-containing protein 1, Ras-GEF domain-containing family member 2

Q76NI1

AHRWSKLRNIAKVVSQVHAFQENPYTFSPDPKLQSYLKQRIARFSGADISTLAADSRANFHQVSSEKHSRK