KRT80 Fragment MS Protein Standard

Keratin, type II cytoskeletal 80

KRT80 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KRT80 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KRT80

Cytokeratin-80, Keratin-80, Type-II keratin Kb20

Q6KB66

ARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTK