LDOC1L Fragment MS Protein Standard

Protein LDOC1L

LDOC1L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LDOC1L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LDOC1L

Leucine zipper protein down-regulated in cancer cells-like, Mammalian retrotransposon-derived protein 6

Q6ICC9

SVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!