LETMD1 Fragment MS Protein Standard

LETM1 domain-containing protein 1

LETMD1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LETMD1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LETMD1

Cervical cancer 1 proto-oncogene protein p40, Cervical cancer proto-oncogene 2 protein, HCCR-1, HCRR-2

Q6P1Q0

RVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGKYHRFLGRHFP