LONRF3 Fragment MS Protein Standard

LON peptidase N-terminal domain and RING finger protein 3

LONRF3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LONRF3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LONRF3

RING finger protein 127

Q496Y0

LMDPAKVKGDGQQHHMKDQEEEEEKWDATSPKAASSKTGKCQEKKRKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDL