LPCAT3 Fragment MS Protein Standard

Lysophospholipid acyltransferase 5

LPCAT3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LPCAT3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LPCAT3

1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, Lysophosphatidylcholine acyltransferase, Lysophosphatidylcholine acyltransferase 3, Lysophosphatidylserine acyltransferase, Membrane-bound O-acyltransferase domai

Q6P1A2

GNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGF